Wordle Hints Today | Clues and Answer

Wordle hints today help you find the correct answer faster using accurate clues and smart strategies. Get daily Wordle tips / hints, today’s answer, and step-by-step guidance to solve the puzzle easily.

December 18, 2024
#1278 Moderate Vowels: 1
Wordle Bot Analytics Global Avg: 4.20 guesses
1
0%
2
3%
3
18%
4
39%
5
29%
6
9%
💡
Strategy Corner

Pro Tip: The letter E appears in position 2 in about 10.4% of all Wordle words.

Wordle Hints

Hint 1: Vague

A quality that makes you more noticeable.

Hint 2: Category

Associated with weightlifters or heavy cargo.

Hint 3: Specific

Describes something that is substantial and impressive.

Final Hint: Strong

Imagine something you might find in a warehouse or a gym.

Today's Answer
NEXT WORDLE 00:00:00

Word Discovery

adjective ˈhef-tē
Definition

quite heavy

Example Usage

a hefty book

Synonyms
heavymassiveponderousweightybigbiggishboxcarbulky
Antonyms
lightweightlessbantamdinkydwarfdwarfishlittlepuny
Etymology & History

Etymology unavailable

First Known Use: 1863 AD

Yesterday’s Answer

Already finished today’s puzzle and curious what yesterday’s word was? in our Wordle Hints today tool Just click the left arrow (←) next to the date in the widget above and it will load the previous day’s full data the word, the hints, the difficulty, everything. One click, instant Yesterday’s answer

You can also access yesterday’s answer in another way. Click on “Show Today’s Answer,” then select the “Previous Day” button to instantly view the previous Wordle.

wordle yesterday answer

yesterday wordle answer second

Wordle Hints Today | How It Works

SMART

Timezone Based Wordle Hints

Get the correct Wordle hint today based on your local time and timezone. You always see the right puzzle never yesterday’s or tomorrow’s.

01
SECURE

Spoiler Proof System

Future answers stay locked until midnight in your timezone keeping the daily Wordle challenge fair and surprising.

02
PROGRESSIVE

4 Level Hint System

Choose between vague category specific or full answer hints and control how much help you need.

03
ANALYTICS

Wordle Bot Insights

Improve your gameplay with smart stats letter insights and strategy based recommendations.

04
DISCOVERY

Word Discovery Hub

Explore meanings synonyms antonyms and word origins while solving Wordle puzzles.

05
ARCHIVE

Wordle Archive and Countdown

Access past Wordle answers anytime and track your next puzzle with a live countdown timer while staying updated with Wordle hints today.

06

Wordle Archive

The Wordle Archive is one of the most underused features on this site. Players land here for today’s puzzle and leave without realizing they are sitting on top of a complete searchable history of every Wordle answer ever published.

Using the calendar inside the hint tool

You do not even need to leave this page to browse past wordle hints and answers. Click on the date navigation bar inside the tool above. A full date picker opens. Select any date any date at all and the tool loads that day’s complete puzzle data instantly. Hints, answer, difficulty, word breakdown everything.

wordle yesterday answer

Want to browse everything at once?

wordle archive three

The dedicated Archive page goes even further. It lists every single Wordle answer in a clean, filterable view organised by date, puzzle number, and difficulty rating. You can see at a glance which months had the hardest words, which puzzles tripped the most players up, and which answers were solved fastest worldwide.


Wordle Solver

The solver instantly filters the full Wordle word list and shows you every word that mathematically fits those conditions. You then look through the candidates, pick the one that feels right, and go try it in the real Wordle game.
You are still making the guess yourself. You are still solving the puzzle. The solver just stops your brain from freezing up when the pressure is highest while using tools like Wordle hints today.

wordle solver

Here is how it works

The Wordle Solver does not just hand you the answer. It works the way your brain should by filtering. You tell it what you know:

Green Tiles

Which letters are confirmed in the correct position.

Yellow Tiles

Which letters are in the word but in the wrong position.

Gray Tiles

Which letters are completely eliminated. So Consider not using them again.

Wordle Hints vs Wordle Solver

Feature
Wordle Hints Today
Wordle Solver
Purpose
Provides clues
Finds exact words
Usage
Manual thinking
Automatic suggestions
Best For
Learning
Quick solving

Understanding Wordle Difficulty


Some days the word comes to you in two guesses. Other days you burn through all six attempts and still feel confused about how you missed it.
That difference is not random. It is measurable. And every puzzle on this site shows you exactly where today’s word sits on the difficulty scale.
The difficulty rating is powered by WordleBot the official post-game analysis tool from New York Times Games. It analyses millions of real Wordle results and calculates how difficult each word was for the global player community, helping provide better context alongside Wordle hints today.

wordle hints today

Rating: What It Means

Very Easy

Most players solved it in 2–3 guesses

Moderate

Average solve around 3.5–4 guesses

Hard

Most players needed 4–5 guesses

Insane

Even experienced players struggled

Double Letters

Words with double letters are almost always rated harder than average. Words like ABBEY, VIVID, or LEVEL catch players out because most opening strategies assume each letter appears only once. Words with uncommon letter combinations like TRYST or NYMPH score highest

Global Average Guesses

The global average guesses number next to Wordle Bot Analytics shows the exact worldwide solve average for that puzzle in relation to Wordle hints today.A lower than average score means you solved it more efficiently than the majority of players globally.


Wordle Strategy Corner

There is a reason some players solve Wordle in two guesses almost every day while others regularly burn through five or six. It is not luck. It is approach. A few consistent habits make a measurable difference.

Starting

Starting Word

Your opening guess should not be a favourite word or a clever flex. It should be a tool. Words like CRANE, STARE, RAISE, and AUDIO are consistently recommended by Wordle analysts because they contain the highest-frequency letters across the full Wordle answer list. A strong first guess eliminates the most possibilities in a single move.

01
Vowels

Vowel Count

Every puzzle on this page tells you exactly how many vowels are in today’s word visible in the header before you even unlock a single hint. Two vowels narrows the field significantly. One vowel narrows it further. Three vowels opens a different set of patterns. Use this number as a quick reference to guide your guesses.

02
Letters

Double Letters

If your confirmed letters seem to fit but no word comes to mind, consider that a letter might appear twice. This is the single most common reason players get stuck in guesses four and five. The solver section was built specifically for this scenario.

03
Rules

Hard Mode

Wordle’s hard mode requires you to reuse every confirmed letter in every subsequent guess. It feels restrictive at first. But it forces pattern discipline that makes standard mode dramatically easier over time. It trains smarter guessing.

04

What is Wordle?

Created By

Josh Wardle built Wordle as a private gift for his partner. It was a simple idea guess a five letter word in six attempts, get colour coded feedback, repeat tomorrow. He released it in October 2021. By January 2022, over 2 million people were playing it every day.

NYT Acquiring

New York Times Games acquired Wordle shortly after for a reported seven-figure sum. It remains free to play on the NYT platform and continues to follow the same simple rules Wardle originally designed. That is exactly what makes Wordle so addictive.

Word Variation

Every player worldwide receives the same word on the same date. No regional variations. No difficulty settings that change the word. It is a shared experience which is precisely why the emoji result grid became such a viral social format.

Here’s how Wordle’s tile system works during gameplay

Green Tiles

correct letter, correct position.

Yellow Tiles

correct letter, wrong position.

Gray Tiles

letter not in the word.


NYT Games Ecosystem

Wordle opened a door. Since then, New York Times Games has built an entire ecosystem of daily puzzles around it — and a thriving independent community of alternatives has grown alongside it.

Inside the NYT Games family

connentions

Connections

Group 16 words into four hidden categories. Harder than it looks.

spelling bee icon clean

Spelling Bee

Find as many words as possible from seven letters. One must use the centre letter.

crossword icon clean

Crossword

A focused crossword that most players complete in under two minutes.

There are more games available in the New York Times collection beyond those mentioned above, as reflected in the popularity stats below

NYT Games Comparison

Game Popularity Difficulty Gameplay Avg Time Best For
Wordle ★★★★★ Medium Guess a 5-letter word 2–5 min Daily players
Connections ★★★★★ Hard Group words into categories 5–10 min Logic thinkers
Mini Crossword ★★★★☆ Easy Quick crossword challenge 1–3 min Fast solvers
Spelling Bee ★★★★☆ Medium Create words from 7 letters 5–15 min Vocabulary lovers
Strands ★★★★☆ Medium Find themed hidden words 4–8 min Pattern seekers
The Crossword ★★★★☆ Hard Full crossword puzzle 10–30 min Advanced players
Sudoku ★★★★☆ Medium Classic number puzzle 5–20 min Logic players
Letter Boxed ★★★☆☆ Medium Connect letters into words 5–10 min Strategic thinkers
Tiles ★★★☆☆ Easy Match visual tile patterns 2–4 min Casual players
Vertex ★★☆☆☆ Easy Connect dots to reveal images 3–6 min Visual puzzle fans
Pips ★★☆☆☆ Hard Domino-style number puzzle 5–12 min Math & logic players

Wordle Alternative Universe

  • Quordle : Four Wordle puzzles happening simultaneously. Chaotic and addictive.
  • Dordle : Two puzzles side by side. A good bridge between Wordle and Quordle.
  • Worldle : Guess the country from its geographic silhouette.

Each of these games borrows Wordle’s core tension the daily deadline, the shared result, the satisfying reveal and applies it to a different domain.

Frequently Asked Questions

It is inside the wordle hints today and answer tool at the top of this page. Work through the progressive hints at your own pace

It is also inside the Today’s wordle hints and answer tool at the top of this page.Click “Show Today’s Answer” when you are ready. The puzzle updates automatically based on your browser’s local time. No manual refresh needed

Click the left arrow (←) in the date navigation bar inside the puzzle tool above. It loads the previous day’s complete puzzle hints, answer, difficulty rating, and full word breakdown instantly. No page reload required.

Yes significantly more. Once you reveal the answer, the Word Discovery section opens automatically. It shows the word’s full Merriam-Webster definition, pronunciation with audio, etymology and origin history, example sentence, synonyms, and antonyms. Every day is a vocabulary lesson disguised as a game.

Yes. Every Wordle player worldwide receives the same word on the same day. The Game does not vary by location, device, or account type. That shared experience is why Wordle results spread so naturally on social media.

Wordle resets at midnight in your local timezone. The countdown timer inside the today’s wordle hints and answer tool above shows exactly how long until the next puzzle goes live. Players in different timezones may be on different puzzles at the same moment

At the top of Wordle hints today Each puzzle shows a difficulty badge Very Easy, Moderate, Hard, or Insane based on real player data from WordleBot, the official NYT Games analysis tool. The rating reflects how many guesses the global Wordle community needed to solve that specific word.

Use it when you are genuinely stuck on your fifth or sixth guess and cannot think of a word that fits your confirmed letters. Enter what you know (green, yellow, and gray letters) and the solver filters all valid remaining words. Always try the real puzzle yourself first. The solver is a lifeline, not a shortcut.

CRANE, STARE, RAISE, AUDIO, and SLATE. These words cover the most frequent letters in the Wordle answer list, giving you the best statistical start.

Yes. The Archive page contains every Wordle answer ever published, organised by date and puzzle number. Use the calendar icon inside the wordle hints today and answer tool to jump to any past date directly or visit the Archive page to browse the full history.

Everything on this site Wordle hints today , the answer, difficulty data, word discovery, Wordle solver, Wordle archive and Multilanguage Wordle unlimited is completely free. No account. No subscription. No paywall.